General Information

  • ID:  hor000200
  • Uniprot ID:  Q25589
  • Protein name:  CHH precursor-related peptide A
  • Gene name:  CHHA
  • Organism:  Faxonius limosus (Spinycheek crayfish) (Orconectes limosus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Faxonius (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVS
  • Length:  33
  • Propeptide:  MVSFRTMWSLVVVVVVASLASSGVQGRSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVSKRQVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTVGK
  • Signal peptide:  MVSFRTMWSLVVVVVVASLASSGVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Ensure the correct folding of the prohormone;assure the proper assignment of cysteine bridges within CHH.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q25589-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000200_AF2.pdbhor000200_ESM.pdb

Physical Information

Mass: 408868 Formula: C143H238N44O57S
Absent amino acids: ACHIKNTWY Common amino acids: S
pI: 4.59 Basic residues: 3
Polar residues: 15 Hydrophobic residues: 7
Hydrophobicity: -57.58 Boman Index: -9422
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 64.85
Instability Index: 9469.09 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1788131
  • Title:  Isolation and Amino Acid Sequence of Crustacean Hyperglycemic Hormone Precursor-Related Peptides